PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400052181
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family TALE
Protein Properties Length: 541aa    MW: 60599.9 Da    PI: 6.9582
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400052181genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.6e-094584961854
                           HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
              Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                           +F++  ++yp+ +e++ LA k gLt +qV++WF N R +
  PGSC0003DMP400052181 458 MFQNflHPYPKDAEKQLLAVKSGLTRSQVSNWFINARVR 496
                           5887779******************************88 PP

2BELL71.81.1e-23332398471
                  BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                           + ++kk  L+ ll+ Vd++Y+q+ +++++vis+F+av++l++  +++++Al++iS  +++L+++i++ 
  PGSC0003DMP400052181 332 DCEAKKKNLVALLQVVDDQYNQCLDEIHMVISAFHAVTELDP-SIHARFALQTISSLYKNLRERISNY 398
                           7899**************************************.9*********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.9E-20254397IPR006563POX domain
PfamPF075266.3E-27260396IPR006563POX domain
PROSITE profilePS5007111.224437500IPR001356Homeobox domain
SMARTSM003895.5E-7440504IPR001356Homeobox domain
CDDcd000861.98E-11440501No hitNo description
SuperFamilySSF466891.5E-15442509IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.8E-26443506IPR009057Homeodomain-like
PfamPF059203.9E-15457496IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MDGQNHIVDG HGIPYPFMLQ GEAVNSSHGF LNVPNFPRSV DTEAIHNVLP AGRSRIKEFT  60
VSTSYPISNA YTEDQYMEGI PISAVSLANL LAARNAMHEN PENLAVLAQL SHPAEGQKID  120
GLDYPNVLNH SFGSYRNYEF DGVSEIAGTV VGRAGSQPFQ LTENVNSNTW FSSETASLSS  180
DSPSGSSRFS NELCLSLTTS QSAVACGTTI RDQCSDISCS GVTNQAFPQR RFDSELTSCN  240
SRNLSLNFGS YKPVHLSQFL TGSRYLRVMQ EILSEIAQLS LQNHNLIGYR GNGMENGANT  300
SFALNSDAGR GYAAMSSDDS PDGDHRIIGL MDCEAKKKNL VALLQVVDDQ YNQCLDEIHM  360
VISAFHAVTE LDPSIHARFA LQTISSLYKN LRERISNYIL AMGEHFNNRG ERGVEKSFET  420
SFIQKQWALQ QLKRKDHQLW RPQRGLPERS VSVLRAWMFQ NFLHPYPKDA EKQLLAVKSG  480
LTRSQVSNWF INARVRLWKP MIEEMYAEMN RRKIRAGNED EANHHRRNHK IIESHLFTMK  540
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A3e-15446503158Homeobox protein Meis1
4xrs_B3e-15446503158Homeobox protein Meis1
5bng_A4e-15446504159Homeobox protein Meis2
5bng_B4e-15446504159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361000.20.0PREDICTED: homeobox protein ATH1
SwissprotP487311e-105ATH1_ARATH; Homeobox protein ATH1
TrEMBLM1CXR70.0M1CXR7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000769950.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-106homeobox gene 1
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]